PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family YABBY
Protein Properties Length: 167aa    MW: 17878.3 Da    PI: 9.1178
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030050genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY150.91.2e-4621472163
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                  d++  se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC++l  ++ +           l+ +     l++  + + ++  ++ +++ +s+s ss 
  DCAR_030050   2 DLVPPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTR---------PPLQGQ----CLDHPASLQAAFGNTDYNKKGQSSSSSS- 85 
                  77899*************************************97543222.........222222....3344444455555555666666665555. PP

        YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                    s++++  +p++p v++PPek+ r Psaynrf+keeiqrik++nP+i hreafsaaaknWa +
  DCAR_030050  86 --STSSEPASPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKTANPEIPHREAFSAAAKNWARY 147
                  ..567788999*9*************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.6E-566147IPR006780YABBY protein
SuperFamilySSF470951.26E-891145IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.8E-5101146IPR009071High mobility group box domain
CDDcd013909.15E-6108144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MDLVPPSEHL CYVRCNFCNT VLAVGIPCKR LLDTVTVKCG HCSNLSFLST RPPLQGQCLD  60
HPASLQAAFG NTDYNKKGQS SSSSSSTSSE PASPKAPFVV KPPEKKHRLP SAYNRFMKEE  120
IQRIKTANPE IPHREAFSAA AKNWARYIPA AASGSISGTS NAGVSD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067816.14e-95PREDICTED: protein CRABS CLAW isoform X2
SwissprotQ76EJ07e-67YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLB9REB68e-94B9REB6_RICCO; Protein CRABS CLAW, putative
STRINGVIT_01s0011g00140.t015e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52102339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.11e-66YABBY family protein